Lineage for d2ftka1 (2ftk A:12-192)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871980Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha)-beta(2)
  4. 871981Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family) (S)
    Histidine kinase-like fold lacking the kinase ATP-binding site
  5. 871982Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein)
  6. 871983Protein Sporulation response regulatory protein Spo0B [55892] (1 species)
  7. 871984Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries)
  8. 871987Domain d2ftka1: 2ftk A:12-192 [134065]
    Other proteins in same PDB: d2ftke1, d2ftkf1, d2ftkg1, d2ftkh1
    automatically matched to d1f51b_
    complexed with bfd, mg; mutant

Details for d2ftka1

PDB Entry: 2ftk (more details), 3.05 Å

PDB Description: berylloflouride spo0f complex with spo0b
PDB Compounds: (A:) sporulation initiation phosphotransferase b

SCOP Domain Sequences for d2ftka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftka1 d.123.1.1 (A:12-192) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl
ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen
hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
d

SCOP Domain Coordinates for d2ftka1:

Click to download the PDB-style file with coordinates for d2ftka1.
(The format of our PDB-style files is described here.)

Timeline for d2ftka1: