![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.183: Major capsid protein gp5 [56562] (1 superfamily) unusual fold; contains PF0899-like core, decorated with additional structure |
![]() | Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) ![]() possibly related to the hypothetical protein PF0899 superfamily (111057) automatically mapped to Pfam PF05065 |
![]() | Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein) |
![]() | Protein Major capsid protein gp5 [56565] (1 species) |
![]() | Species Bacteriophage HK97 [TaxId:37554] [56566] (5 PDB entries) |
![]() | Domain d2fted1: 2fte D:104-383 [134063] automatically matched to d1ohga_ |
PDB Entry: 2fte (more details)
SCOPe Domain Sequences for d2fted1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fted1 d.183.1.1 (D:104-383) Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37554]} slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv evsredrdnfvknmltilceerlalahyrptaiikgtfss
Timeline for d2fted1:
![]() Domains from other chains: (mouse over for more information) d2ftea1, d2fteb1, d2ftec1, d2ftee1 |