SCOP 1.73: Domain d2ftdb1: 2ftd B:1-215

Lineage for d2ftdb1 (2ftd B:1-215)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein (Pro)cathepsin K [54028] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (28 PDB entries)

8. Domain d2ftdb1: 2ftd B:1-215 [134059]
   automatically matched to d1atk__
   complexed with ili

Details for d2ftdb1

PDB Entry: 2ftd, 2.55 Å

PDB Description: Crystal structure of Cathepsin K complexed with 7-Methyl-Substituted Azepan-3-one compound

PDB Compounds: (B:) cathepsin k

SCOP Domain Sequences for d2ftdb1:

Sequence; same for both SEQRES and ATOM records:

>d2ftdb1 d.3.1.1 (B:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d2ftdb1:

• d2ftdb1 is new in SCOP 1.73
  
• d2ftdb1 appears in SCOP 1.75
  
• d2ftdb1 appears in the current release, SCOPe 2.08, called d2ftdb_