Lineage for d2ftba_ (2ftb A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805235Protein automated matches [190295] (6 species)
    not a true protein
  7. 2805236Species Axolotl (Ambystoma mexicanum) [TaxId:8296] [187103] (1 PDB entry)
  8. 2805237Domain d2ftba_: 2ftb A: [134057]
    automated match to d1mvga_
    complexed with ola

Details for d2ftba_

PDB Entry: 2ftb (more details), 2 Å

PDB Description: Crystal structure of axolotl (Ambystoma mexicanum) liver bile acid-binding protein bound to oleic acid
PDB Compounds: (A:) Fatty acid-binding protein 2, liver

SCOPe Domain Sequences for d2ftba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftba_ b.60.1.2 (A:) automated matches {Axolotl (Ambystoma mexicanum) [TaxId: 8296]}
pfngtwqvysqenyeaflravglpediinvakdinpiieiqqngdnfvvtsktpnqsvtn
sftigkeaeitsmggkkikctvvleggklvsktdqfshiqevkgnemvetltvggatlir
rskrv

SCOPe Domain Coordinates for d2ftba_:

Click to download the PDB-style file with coordinates for d2ftba_.
(The format of our PDB-style files is described here.)

Timeline for d2ftba_: