![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein automated matches [190295] (6 species) not a true protein |
![]() | Species Axolotl (Ambystoma mexicanum) [TaxId:8296] [187103] (1 PDB entry) |
![]() | Domain d2ftba_: 2ftb A: [134057] automated match to d1mvga_ complexed with ola |
PDB Entry: 2ftb (more details), 2 Å
SCOPe Domain Sequences for d2ftba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftba_ b.60.1.2 (A:) automated matches {Axolotl (Ambystoma mexicanum) [TaxId: 8296]} pfngtwqvysqenyeaflravglpediinvakdinpiieiqqngdnfvvtsktpnqsvtn sftigkeaeitsmggkkikctvvleggklvsktdqfshiqevkgnemvetltvggatlir rskrv
Timeline for d2ftba_: