Lineage for d2ft9a1 (2ft9 A:1-125)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414644Protein Liver basic fatty acid binding protein, LB_FABP [89368] (3 species)
  7. 2414647Species Axolotl (Ambystoma mexicanum) [TaxId:8296] [141465] (1 PDB entry)
    Uniprot P81400 1-125
  8. 2414648Domain d2ft9a1: 2ft9 A:1-125 [134056]
    complexed with chd

Details for d2ft9a1

PDB Entry: 2ft9 (more details), 2.5 Å

PDB Description: Crystal structure of axolotl (Ambystoma mexicanum) liver bile acid-binding protein bound to cholic acid
PDB Compounds: (A:) Fatty acid-binding protein 2, liver

SCOPe Domain Sequences for d2ft9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ft9a1 b.60.1.2 (A:1-125) Liver basic fatty acid binding protein, LB_FABP {Axolotl (Ambystoma mexicanum) [TaxId: 8296]}
pfngtwqvysqenyeaflravglpediinvakdinpiieiqqngdnfvvtsktpnqsvtn
sftigkeaeitsmggkkikctvvleggklvsktdqfshiqevkgnemvetltvggatlir
rskrv

SCOPe Domain Coordinates for d2ft9a1:

Click to download the PDB-style file with coordinates for d2ft9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ft9a1: