Lineage for d2ft9a1 (2ft9 A:1-125)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673924Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 674044Protein Liver basic fatty acid binding protein, LB_FABP [89368] (3 species)
  7. 674047Species Axolotl (Ambystoma mexicanum) [TaxId:8296] [141465] (2 PDB entries)
  8. 674049Domain d2ft9a1: 2ft9 A:1-125 [134056]
    complexed with chd

Details for d2ft9a1

PDB Entry: 2ft9 (more details), 2.5 Å

PDB Description: Crystal structure of axolotl (Ambystoma mexicanum) liver bile acid-binding protein bound to cholic acid
PDB Compounds: (A:) Fatty acid-binding protein 2, liver

SCOP Domain Sequences for d2ft9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ft9a1 b.60.1.2 (A:1-125) Liver basic fatty acid binding protein, LB_FABP {Axolotl (Ambystoma mexicanum) [TaxId: 8296]}
pfngtwqvysqenyeaflravglpediinvakdinpiieiqqngdnfvvtsktpnqsvtn
sftigkeaeitsmggkkikctvvleggklvsktdqfshiqevkgnemvetltvggatlir
rskrv

SCOP Domain Coordinates for d2ft9a1:

Click to download the PDB-style file with coordinates for d2ft9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ft9a1: