Class b: All beta proteins [48724] (165 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (8 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Liver basic fatty acid binding protein, LB_FABP [89368] (3 species) |
Species Axolotl (Ambystoma mexicanum) [TaxId:8296] [141465] (2 PDB entries) |
Domain d2ft9a1: 2ft9 A:1-125 [134056] complexed with chd |
PDB Entry: 2ft9 (more details), 2.5 Å
SCOP Domain Sequences for d2ft9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ft9a1 b.60.1.2 (A:1-125) Liver basic fatty acid binding protein, LB_FABP {Axolotl (Ambystoma mexicanum) [TaxId: 8296]} pfngtwqvysqenyeaflravglpediinvakdinpiieiqqngdnfvvtsktpnqsvtn sftigkeaeitsmggkkikctvvleggklvsktdqfshiqevkgnemvetltvggatlir rskrv
Timeline for d2ft9a1: