| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.183: Major capsid protein gp5 [56562] (1 superfamily) unusual fold; contains PF0899-like core, decorated with additional structure |
Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) ![]() possibly related to the hypothetical protein PF0899 superfamily (111057) automatically mapped to Pfam PF05065 |
| Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein) |
| Protein Major capsid protein gp5 [56565] (1 species) |
| Species Bacteriophage HK97 [TaxId:37554] [56566] (5 PDB entries) |
| Domain d2ft1d1: 2ft1 D:104-383 [134052] automatically matched to d1ohga_ |
PDB Entry: 2ft1 (more details), 3.9 Å
SCOPe Domain Sequences for d2ft1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ft1d1 d.183.1.1 (D:104-383) Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37554]}
slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
evsredrdnfvknmltilceerlalahyrptaiikgtfss
Timeline for d2ft1d1:
View in 3DDomains from other chains: (mouse over for more information) d2ft1a1, d2ft1b1, d2ft1c1, d2ft1e1 |