Lineage for d2ft1d1 (2ft1 D:104-383)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739122Fold d.183: Major capsid protein gp5 [56562] (1 superfamily)
    unusual fold; contains PF0899-like core, decorated with additional structure
  4. 739123Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) (S)
    possibly related to the hypothetical protein PF0899 superfamily (scop_sf 111057)
  5. 739124Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein)
  6. 739125Protein Major capsid protein gp5 [56565] (1 species)
  7. 739126Species Bacteriophage HK97 [TaxId:37554] [56566] (5 PDB entries)
  8. 739130Domain d2ft1d1: 2ft1 D:104-383 [134052]
    automatically matched to d1ohga_

Details for d2ft1d1

PDB Entry: 2ft1 (more details), 3.9 Å

PDB Description: bacteriophage hk97 head ii
PDB Compounds: (D:) Major capsid protein

SCOP Domain Sequences for d2ft1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ft1d1 d.183.1.1 (D:104-383) Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37554]}
slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
evsredrdnfvknmltilceerlalahyrptaiikgtfss

SCOP Domain Coordinates for d2ft1d1:

Click to download the PDB-style file with coordinates for d2ft1d1.
(The format of our PDB-style files is described here.)

Timeline for d2ft1d1: