Lineage for d2ft1a1 (2ft1 A:104-383)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005070Fold d.183: Major capsid protein gp5 [56562] (1 superfamily)
    unusual fold; contains PF0899-like core, decorated with additional structure
  4. 3005071Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) (S)
    possibly related to the hypothetical protein PF0899 superfamily (111057)
    automatically mapped to Pfam PF05065
  5. 3005072Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein)
  6. 3005073Protein Major capsid protein gp5 [56565] (1 species)
  7. 3005074Species Bacteriophage HK97 [TaxId:37554] [56566] (5 PDB entries)
  8. 3005080Domain d2ft1a1: 2ft1 A:104-383 [134049]
    automatically matched to d1ohga_

Details for d2ft1a1

PDB Entry: 2ft1 (more details), 3.9 Å

PDB Description: bacteriophage hk97 head ii
PDB Compounds: (A:) Major capsid protein

SCOPe Domain Sequences for d2ft1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ft1a1 d.183.1.1 (A:104-383) Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37554]}
slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
evsredrdnfvknmltilceerlalahyrptaiikgtfss

SCOPe Domain Coordinates for d2ft1a1:

Click to download the PDB-style file with coordinates for d2ft1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ft1a1: