SCOP 1.75: Domain d2fswb1: 2fsw B:3-104

Lineage for d2fswb1 (2fsw B:3-104)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.69: HxlR-like [140304] (5 proteins)
   Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801))

6. Protein Hypothetical protein PG0823 [140305] (1 species)

7. Species Porphyromonas gingivalis [TaxId:837] [140306] (1 PDB entry)
   Uniprot Q7M7B7 3-104

8. Domain d2fswb1: 2fsw B:3-104 [134043]
   automatically matched to 2FSW A:3-104

Details for d2fswb1

PDB Entry: 2fsw, 2.16 Å

PDB Description: Crystal Structure of the Putative Transcriptional Regualator, MarR family from Porphyromonas gingivalis W83

PDB Compounds: (B:) PG_0823 protein

SCOP Domain Sequences for d2fswb1:

Sequence; same for both SEQRES and ATOM records:

>d2fswb1 a.4.5.69 (B:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]}
rkisdeecpvrksmqifagkwtlliifqinrriirygelkraipgisekmlidelkflcg
kglikkkqypevpprveysltplgekvlpiideiakfgmenl

Timeline for d2fswb1:

• d2fswb1 first appeared in SCOP 1.73
  
• d2fswb1 is called d2fswb_ in SCOPe 2.01
  
• d2fswb1 appears in the current release, SCOPe 2.08, called d2fswb_