SCOPe 2.08: Domain d2fsva1: 2fsv A:144-326

Lineage for d2fsva1 (2fsv A:144-326)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries)

8. Domain d2fsva1: 2fsv A:144-326 [134037]
   Other proteins in same PDB: d2fsva2, d2fsvb2, d2fsvc1
   automatically matched to d1f8ga1
   complexed with gol, nad, nap

Details for d2fsva1

PDB Entry: 2fsv, 2.3 Å

PDB Description: structure of transhydrogenase (di.d135n.nad+)2(diii.e155w.nadp+)1 asymmetric complex

PDB Compounds: (A:) NAD(P) transhydrogenase subunit alpha part 1

SCOPe Domain Sequences for d2fsva1:

Sequence, based on SEQRES records:

>d2fsva1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records):

>d2fsva1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvgyakemgeefrkkqaeavlkelvktdiaittalipgkpapvl
iteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

Timeline for d2fsva1:

• d2fsva1 first appeared in SCOP 1.73
  
• d2fsva1 appears in SCOPe 2.07