Lineage for d2fsra1 (2fsr A:4-167)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533423Protein Probable acetyltranferase Atu2435 [143704] (1 species)
  7. 2533424Species Agrobacterium tumefaciens [TaxId:358] [143705] (1 PDB entry)
    Uniprot Q8UCP8 4-167
  8. 2533425Domain d2fsra1: 2fsr A:4-167 [134036]
    Other proteins in same PDB: d2fsra2
    complexed with fmt, peg

Details for d2fsra1

PDB Entry: 2fsr (more details), 1.52 Å

PDB Description: Crystal Structure of the Acetyltransferase from Agrobacterium tumefaciens str. C58
PDB Compounds: (A:) Acetyltransferase

SCOPe Domain Sequences for d2fsra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]}
siptlrterltlrplamadfpayrdfmasprstgvggpydlpstwgvfchdlanwhffgh
galmidlgetgecigqiginhgplfpekelgwllyeghegrgyaaeaavalrdwafetln
lptlvsyvspqnrksaavaeriggtldplaprsdpedlvyryhq

SCOPe Domain Coordinates for d2fsra1:

Click to download the PDB-style file with coordinates for d2fsra1.
(The format of our PDB-style files is described here.)

Timeline for d2fsra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fsra2