Lineage for d2fsqa1 (2fsq A:6-237)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. Family d.61.1.4: Atu0111-like [143484] (1 protein)
  6. Protein Putative phosphoesterase Atu0111 [143485] (1 species)
  7. Species Agrobacterium tumefaciens [TaxId:358] [143486] (1 PDB entry)
    Uniprot Q8UJ27 6-237
  8. Domain d2fsqa1: 2fsq A:6-237 [134035]
    complexed with acy

Details for d2fsqa1

PDB Entry: 2fsq (more details), 1.4 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function ATU0111 from Agrobacterium tumefaciens str. C58
PDB Compounds: (A:) Atu0111 protein

SCOPe Domain Sequences for d2fsqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fsqa1 d.61.1.4 (A:6-237) Putative phosphoesterase Atu0111 {Agrobacterium tumefaciens [TaxId: 358]}
vskdldyistanhdqpprhlgsrfsaegeflpepgntvvchlvegsqtesaivstrqrfl
dmpeasqlaftpvsslhmtvfqgviesrralpywpqtlpldtpidavtdyyrdrlstfpt
lpafnmrvtglrpvgmvmkgataeddsivalwrdtfadffgyrhpdhdtyefhitlsyiv
swfepeclprwqamldeeleklrvaapviqmrppafcefkdmnhfkelvvfd

SCOPe Domain Coordinates for d2fsqa1 are not available.

Timeline for d2fsqa1: