![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
![]() | Superfamily d.61.1: LigT-like [55144] (5 families) ![]() |
![]() | Family d.61.1.4: Atu0111-like [143484] (1 protein) |
![]() | Protein Putative phosphoesterase Atu0111 [143485] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [143486] (1 PDB entry) Uniprot Q8UJ27 6-237 |
![]() | Domain d2fsqa1: 2fsq A:6-237 [134035] complexed with acy |
PDB Entry: 2fsq (more details), 1.4 Å
SCOPe Domain Sequences for d2fsqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fsqa1 d.61.1.4 (A:6-237) Putative phosphoesterase Atu0111 {Agrobacterium tumefaciens [TaxId: 358]} vskdldyistanhdqpprhlgsrfsaegeflpepgntvvchlvegsqtesaivstrqrfl dmpeasqlaftpvsslhmtvfqgviesrralpywpqtlpldtpidavtdyyrdrlstfpt lpafnmrvtglrpvgmvmkgataeddsivalwrdtfadffgyrhpdhdtyefhitlsyiv swfepeclprwqamldeeleklrvaapviqmrppafcefkdmnhfkelvvfd
Timeline for d2fsqa1: