SCOPe 2.08: Domain d2fskb2: 2fsk B:1-164

Lineage for d2fskb2 (2fsk B:1-164)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.12: Ta0583-like [142481] (1 protein)

6. Protein Hypothetical protein Ta0583 [142482] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [142483] (3 PDB entries)
   Uniprot Q9HKL4 1-164! Uniprot Q9HKL4 165-325

8. Domain d2fskb2: 2fsk B:1-164 [134030]
   automated match to d2fsja2

Details for d2fskb2

PDB Entry: 2fsk, 2.1 Å

PDB Description: Crystal structure of Ta0583, an archaeal actin homolog, SeMet data

PDB Compounds: (B:) hypothetical protein Ta0583

SCOPe Domain Sequences for d2fskb2:

Sequence, based on SEQRES records:

>d2fskb2 c.55.1.12 (B:1-164) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]}
mvvvgldvgygdtkvigvdgkriifpsrwavteteswgiggkipvlstdggqtkfiygky
asgnnirvpqgdgrlaskeafpliaaalwesgihndgspvdlvigsgtplgtfdlevkaa
kealenkvltvtgpegevrqfnitrlimrpqgvgaalyllnqgi

Sequence, based on observed residues (ATOM records):

>d2fskb2 c.55.1.12 (B:1-164) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]}
mvvvgldvgygdtkvigvdgkriifpsrwavteteswgiggkipvlstdggqtkfiygky
asgnnirvpqgdgrlaskeafpliaaalwesgihgspvdlvigsgtplgtfdlevkaake
alenkvltvtgpegevrqfnitrlimrpqgvgaalyllnqgi

Timeline for d2fskb2:

• d2fskb2 first appeared in SCOP 1.73
  
• d2fskb2 appears in SCOPe 2.07