| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.12: Ta0583-like [142481] (1 protein) |
| Protein Hypothetical protein Ta0583 [142482] (1 species) |
| Species Thermoplasma acidophilum [TaxId:2303] [142483] (3 PDB entries) Uniprot Q9HKL4 1-164! Uniprot Q9HKL4 165-325 |
| Domain d2fskb1: 2fsk B:165-326 [134029] automated match to d2fsja1 |
PDB Entry: 2fsk (more details), 2.1 Å
SCOPe Domain Sequences for d2fskb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fskb1 c.55.1.12 (B:165-326) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]}
ieqqpgygvvidvgsrttdvltinlmdmepvvelsfslqigvgdaisalsrkiaketgfv
vpfdlaqealshpvmfrqkqvggpevsgpiledlanriienirlnlrgevdrvtslipvg
ggsnligdrfeeiapgtlvkikpedlqfanalgyrdaaersm
Timeline for d2fskb1: