SCOPe 2.08: Domain d2fskb1: 2fsk B:165-326

Lineage for d2fskb1 (2fsk B:165-326)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.12: Ta0583-like [142481] (1 protein)

6. Protein Hypothetical protein Ta0583 [142482] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [142483] (3 PDB entries)
   Uniprot Q9HKL4 1-164! Uniprot Q9HKL4 165-325

8. Domain d2fskb1: 2fsk B:165-326 [134029]
   automated match to d2fsja1

Details for d2fskb1

PDB Entry: 2fsk, 2.1 Å

PDB Description: Crystal structure of Ta0583, an archaeal actin homolog, SeMet data

PDB Compounds: (B:) hypothetical protein Ta0583

SCOPe Domain Sequences for d2fskb1:

Sequence; same for both SEQRES and ATOM records:

>d2fskb1 c.55.1.12 (B:165-326) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]}
ieqqpgygvvidvgsrttdvltinlmdmepvvelsfslqigvgdaisalsrkiaketgfv
vpfdlaqealshpvmfrqkqvggpevsgpiledlanriienirlnlrgevdrvtslipvg
ggsnligdrfeeiapgtlvkikpedlqfanalgyrdaaersm

Timeline for d2fskb1:

• d2fskb1 first appeared in SCOP 1.73
  
• d2fskb1 appears in SCOPe 2.07