SCOPe 2.07: Domain d2fsed2: 2fse D:4-92

Lineage for d2fsed2 (2fse D:4-92)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries)

8. Domain d2fsed2: 2fse D:4-92 [134024]
   Other proteins in same PDB: d2fsea1, d2fseb1, d2fsec1, d2fsed1
   automated match to d1klub2

Details for d2fsed2

PDB Entry: 2fse, 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen

PDB Compounds: (D:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2fsed2:

Sequence; same for both SEQRES and ATOM records:

>d2fsed2 d.19.1.1 (D:4-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
qkdlleqrraavdtycrhnygvgesftvq

Timeline for d2fsed2:

• d2fsed2 first appeared in SCOP 1.73
  
• d2fsed2 appears in SCOPe 2.06
  
• d2fsed2 appears in the current release, SCOPe 2.08