Lineage for d2fsec1 (2fse C:83-180)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291899Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1291965Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (24 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1291989Domain d2fsec1: 2fse C:83-180 [134021]
    Other proteins in same PDB: d2fsea2, d2fseb1, d2fseb2, d2fsec2, d2fsed1, d2fsed2
    automatically matched to d1k2da1

Details for d2fsec1

PDB Entry: 2fse (more details), 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
PDB Compounds: (C:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d2fsec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fsec1 b.1.1.2 (C:83-180) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprdd
hlfrkfhyltflpstddfydcevdhwgleeplrkhwef

SCOPe Domain Coordinates for d2fsec1:

Click to download the PDB-style file with coordinates for d2fsec1.
(The format of our PDB-style files is described here.)

Timeline for d2fsec1: