Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (24 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d2fsea1: 2fse A:83-181 [134017] Other proteins in same PDB: d2fsea2, d2fseb1, d2fseb2, d2fsec2, d2fsed1, d2fsed2 automatically matched to d1k2da1 |
PDB Entry: 2fse (more details), 3.1 Å
SCOPe Domain Sequences for d2fsea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fsea1 b.1.1.2 (A:83-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} tnvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprdd hlfrkfhyltflpstddfydcevdhwgleeplrkhwefe
Timeline for d2fsea1: