Lineage for d2fs9a_ (2fs9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404556Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 2404557Species Human (Homo sapiens) [TaxId:9606] [50547] (22 PDB entries)
  8. 2404609Domain d2fs9a_: 2fs9 A: [134013]
    automated match to d1a0la_
    complexed with c4a

Details for d2fs9a_

PDB Entry: 2fs9 (more details), 2.3 Å

PDB Description: human beta tryptase ii with inhibitor cra-28427
PDB Compounds: (A:) Tryptase beta-2

SCOPe Domain Sequences for d2fs9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fs9a_ b.47.1.2 (A:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d2fs9a_:

Click to download the PDB-style file with coordinates for d2fs9a_.
(The format of our PDB-style files is described here.)

Timeline for d2fs9a_: