Lineage for d2fs7b_ (2fs7 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414439Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 2414446Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (74 PDB entries)
  8. 2414467Domain d2fs7b_: 2fs7 B: [134008]
    automated match to d1blr__
    complexed with act, cl

Details for d2fs7b_

PDB Entry: 2fs7 (more details), 1.55 Å

PDB Description: crystal structure of apo-cellular retinoic acid binding protein type ii at 1.55 angstroms resolution
PDB Compounds: (B:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d2fs7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fs7b_ b.60.1.2 (B:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

SCOPe Domain Coordinates for d2fs7b_:

Click to download the PDB-style file with coordinates for d2fs7b_.
(The format of our PDB-style files is described here.)

Timeline for d2fs7b_: