SCOP 1.75: Domain d2fs7a1: 2fs7 A:2-137

Lineage for d2fs7a1 (2fs7 A:2-137)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (10 PDB entries)

8. Domain d2fs7a1: 2fs7 A:2-137 [134007]
   automatically matched to d1blr__
   complexed with act, cl

Details for d2fs7a1

PDB Entry: 2fs7, 1.55 Å

PDB Description: crystal structure of apo-cellular retinoic acid binding protein type ii at 1.55 angstroms resolution

PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOP Domain Sequences for d2fs7a1:

Sequence; same for both SEQRES and ATOM records:

>d2fs7a1 b.60.1.2 (A:2-137) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
nfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrtt
einfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgelil
tmtaddvvctrvyvre

Timeline for d2fs7a1:

• d2fs7a1 first appeared in SCOP 1.73
  
• d2fs7a1 is called d2fs7a_ in SCOPe 2.01
  
• d2fs7a1 appears in the current release, SCOPe 2.08, called d2fs7a_