Lineage for d2fs6a1 (2fs6 A:2-137)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673924Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 673954Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 673961Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (10 PDB entries)
  8. 673962Domain d2fs6a1: 2fs6 A:2-137 [134005]
    automatically matched to d1blr__
    complexed with act, cl, na

Details for d2fs6a1

PDB Entry: 2fs6 (more details), 1.35 Å

PDB Description: crystal structure of apo-cellular retinoic acid binding protein type ii at 1.35 angstroms resolution
PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOP Domain Sequences for d2fs6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fs6a1 b.60.1.2 (A:2-137) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
nfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrtt
einfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgelil
tmtaddvvctrvyvre

SCOP Domain Coordinates for d2fs6a1:

Click to download the PDB-style file with coordinates for d2fs6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fs6a1: