Lineage for d2fs2a1 (2fs2 A:1-131)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721568Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)
  6. 721646Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)
  7. 721647Species Escherichia coli [TaxId:562] [89904] (2 PDB entries)
  8. 721648Domain d2fs2a1: 2fs2 A:1-131 [134003]
    complexed with so4

Details for d2fs2a1

PDB Entry: 2fs2 (more details), 2 Å

PDB Description: structure of the e. coli paai protein from the phyenylacetic acid degradation operon
PDB Compounds: (A:) Phenylacetic acid degradation protein paaI

SCOP Domain Sequences for d2fs2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]}
lshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsla
dtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqk
tvalfrgkshr

SCOP Domain Coordinates for d2fs2a1:

Click to download the PDB-style file with coordinates for d2fs2a1.
(The format of our PDB-style files is described here.)

Timeline for d2fs2a1: