![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (1 family) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (21 proteins) |
![]() | Protein Cytochrome P450-CAM [48266] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [48267] (57 PDB entries) |
![]() | Domain d2frzb1: 2frz B:10-414 [134002] automatically matched to d1j51a_ complexed with hem, k; mutant |
PDB Entry: 2frz (more details), 2.1 Å
SCOP Domain Sequences for d2frzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2frzb1 a.104.1.1 (B:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d2frzb1: