Lineage for d2frzb1 (2frz B:10-414)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646437Protein Cytochrome P450-CAM [48266] (1 species)
  7. 646438Species Pseudomonas putida [TaxId:303] [48267] (57 PDB entries)
  8. 646496Domain d2frzb1: 2frz B:10-414 [134002]
    automatically matched to d1j51a_
    complexed with hem, k; mutant

Details for d2frzb1

PDB Entry: 2frz (more details), 2.1 Å

PDB Description: Crystal Structure of Cytochrome P450cam mutant (F87W/Y96F/V247L/C334A)
PDB Compounds: (B:) Cytochrome P450-cam

SCOP Domain Sequences for d2frzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frzb1 a.104.1.1 (B:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d2frzb1:

Click to download the PDB-style file with coordinates for d2frzb1.
(The format of our PDB-style files is described here.)

Timeline for d2frzb1: