SCOP 1.75: Domain d2frqb1: 2frq B:1-218

Lineage for d2frqb1 (2frq B:1-218)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (20 PDB entries)

8. Domain d2frqb1: 2frq B:1-218 [134000]
   automatically matched to d1ms6a_
   complexed with c71

Details for d2frqb1

PDB Entry: 2frq, 1.6 Å

PDB Description: human cathepsin s with inhibitor cra-26871

PDB Compounds: (B:) cathepsin S

SCOP Domain Sequences for d2frqb1:

Sequence; same for both SEQRES and ATOM records:

>d2frqb1 d.3.1.1 (B:1-218) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2frqb1:

• d2frqb1 first appeared in SCOP 1.73
  
• d2frqb1 is called d2frqb_ in SCOPe 2.01
  
• d2frqb1 appears in the current release, SCOPe 2.08, called d2frqb_