![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (16 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (25 proteins) |
![]() | Protein (Pro)cathepsin S [82566] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82567] (17 PDB entries) |
![]() | Domain d2frqb1: 2frq B:1-218 [134000] automatically matched to d1ms6a_ complexed with c71 |
PDB Entry: 2frq (more details), 1.6 Å
SCOP Domain Sequences for d2frqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2frqb1 d.3.1.1 (B:1-218) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw lvknswghnfgeegyirmarnkgnhcgiasfpsypei
Timeline for d2frqb1: