SCOPe 2.05: Domain d2frqa_: 2frq A:

Lineage for d2frqa_ (2frq A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187102] (7 PDB entries)

8. Domain d2frqa_: 2frq A: [133999]
   automated match to d1ms6a_
   complexed with c71

Details for d2frqa_

PDB Entry: 2frq, 1.6 Å

PDB Description: human cathepsin s with inhibitor cra-26871

PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d2frqa_:

Sequence; same for both SEQRES and ATOM records:

>d2frqa_ d.3.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
wlvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2frqa_:

• d2frqa_ first appeared in SCOP 1.73, called d2frqa1
  
• d2frqa_ appears in SCOPe 2.04
  
• d2frqa_ appears in SCOPe 2.06
  
• d2frqa_ appears in the current release, SCOPe 2.08