Lineage for d2frpb1 (2frp B:104-383)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005070Fold d.183: Major capsid protein gp5 [56562] (1 superfamily)
    unusual fold; contains PF0899-like core, decorated with additional structure
  4. 3005071Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) (S)
    possibly related to the hypothetical protein PF0899 superfamily (111057)
    automatically mapped to Pfam PF05065
  5. 3005072Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein)
  6. 3005073Protein Major capsid protein gp5 [56565] (1 species)
  7. 3005074Species Bacteriophage HK97 [TaxId:37554] [56566] (5 PDB entries)
  8. 3005093Domain d2frpb1: 2frp B:104-383 [133995]
    automatically matched to d1ohga_

Details for d2frpb1

PDB Entry: 2frp (more details), 7.5 Å

PDB Description: bacteriophage hk97 expansion intermediate iv
PDB Compounds: (B:) Major capsid protein

SCOPe Domain Sequences for d2frpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frpb1 d.183.1.1 (B:104-383) Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37554]}
slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
evsredrdnfvknmltilceerlalahyrptaiikgtfss

SCOPe Domain Coordinates for d2frpb1:

Click to download the PDB-style file with coordinates for d2frpb1.
(The format of our PDB-style files is described here.)

Timeline for d2frpb1: