SCOPe 2.04: Domain d2frkx_: 2frk X:

Lineage for d2frkx_ (2frk X:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (65 PDB entries)

8. Domain d2frkx_: 2frk X: [133992]
   automated match to d1azi__
   complexed with hem, no, so4

Details for d2frkx_

PDB Entry: 2frk, 1.3 Å

PDB Description: Nitrosyl Horse Heart Myoglobin, Nitric Oxide Gas Method

PDB Compounds: (X:) Myoglobin

SCOPe Domain Sequences for d2frkx_:

Sequence; same for both SEQRES and ATOM records:

>d2frkx_ a.1.1.2 (X:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d2frkx_:

• d2frkx_ first appeared in SCOP 1.73, called d2frkx1
  
• d2frkx_ appears in SCOPe 2.03
  
• d2frkx_ appears in SCOPe 2.05
  
• d2frkx_ appears in the current release, SCOPe 2.08