Lineage for d2frix_ (2fri X:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978082Protein Myoglobin [46469] (9 species)
  7. 1978087Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)
  8. 1978115Domain d2frix_: 2fri X: [133990]
    automated match to d1azi__
    complexed with hem, no2, so4

Details for d2frix_

PDB Entry: 2fri (more details), 1.6 Å

PDB Description: Horse Heart Myoglobin, Nitrite Adduct, Co-crystallized
PDB Compounds: (X:) Myoglobin

SCOPe Domain Sequences for d2frix_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frix_ a.1.1.2 (X:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d2frix_:

Click to download the PDB-style file with coordinates for d2frix_.
(The format of our PDB-style files is described here.)

Timeline for d2frix_: