SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2frix_ (2fri X:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978082Protein Myoglobin [46469] (9 species)
  7. 1978087Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)
  8. 1978115Domain d2frix_: 2fri X: [133990]
    automated match to d1azi__
    complexed with hem, no2, so4

Details for d2frix_

PDB Entry: 2fri (more details), 1.6 Å

PDB Description: Horse Heart Myoglobin, Nitrite Adduct, Co-crystallized
PDB Compounds: (X:) Myoglobin

SCOPe Domain Sequences for d2frix_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frix_ a.1.1.2 (X:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d2frix_:

Click to download the PDB-style file with coordinates for d2frix_.
(The format of our PDB-style files is described here.)

Timeline for d2frix_: