Lineage for d2frhb1 (2frh B:102-216)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635444Family a.4.5.28: MarR-like transcriptional regulators [63379] (16 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 635470Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species)
    closely related to SarR but adopts a different fold; possible experimental artifact?
  7. 635471Species Staphylococcus aureus [TaxId:1280] [48293] (3 PDB entries)
  8. 635473Domain d2frhb1: 2frh B:102-216 [133989]
    automatically matched to d1fzpb_
    complexed with ca

Details for d2frhb1

PDB Entry: 2frh (more details), 2.5 Å

PDB Description: Crystal Structure of Sara, A Transcription Regulator From Staphylococcus Aureus
PDB Compounds: (B:) Staphylococcal accessory regulator A

SCOP Domain Sequences for d2frhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frhb1 a.4.5.28 (B:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrit

SCOP Domain Coordinates for d2frhb1:

Click to download the PDB-style file with coordinates for d2frhb1.
(The format of our PDB-style files is described here.)

Timeline for d2frhb1: