Lineage for d2frha2 (2frh A:102-224)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306333Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 protein domains)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2306363Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species)
    closely related to SarR but adopts a different fold; possible experimental artifact?
  7. 2306364Species Staphylococcus aureus [TaxId:1280] [48293] (3 PDB entries)
  8. 2306365Domain d2frha2: 2frh A:102-224 [133988]
    Other proteins in same PDB: d2frha3, d2frhb3
    automated match to d1fzpb_
    complexed with ca

Details for d2frha2

PDB Entry: 2frh (more details), 2.5 Å

PDB Description: Crystal Structure of Sara, A Transcription Regulator From Staphylococcus Aureus
PDB Compounds: (A:) Staphylococcal accessory regulator A

SCOPe Domain Sequences for d2frha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frha2 a.4.5.28 (A:102-224) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkriteanne
iel

SCOPe Domain Coordinates for d2frha2:

Click to download the PDB-style file with coordinates for d2frha2.
(The format of our PDB-style files is described here.)

Timeline for d2frha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2frha3