Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Horse (Equus caballus) [TaxId:9796] [46474] (80 PDB entries) |
Domain d2frfa_: 2frf A: [133987] automated match to d1azi__ complexed with hem, no2, so4 |
PDB Entry: 2frf (more details), 1.2 Å
SCOPe Domain Sequences for d2frfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2frfa_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]} glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp gdfgadaqgamtkalelfrndiaakykelgfq
Timeline for d2frfa_: