Lineage for d2freb_ (2fre B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423301Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 1423302Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 1423303Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 1423337Protein NAD(P)H-flavin oxidoreductase Atu0013 [143616] (1 species)
  7. 1423338Species Agrobacterium tumefaciens [TaxId:358] [143617] (1 PDB entry)
    Uniprot Q8UJB5 1-200
  8. 1423340Domain d2freb_: 2fre B: [133986]
    automated match to d2frea1
    complexed with fmn

Details for d2freb_

PDB Entry: 2fre (more details), 1.9 Å

PDB Description: The crystal structure of the oxidoreductase containing FMN
PDB Compounds: (B:) NAD(P)H-flavin oxidoreductase

SCOPe Domain Sequences for d2freb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2freb_ d.90.1.1 (B:) NAD(P)H-flavin oxidoreductase Atu0013 {Agrobacterium tumefaciens [TaxId: 358]}
mtnsnnrqseypvdplfldrwsprafdgspmpkehlltildaahwapsasnhqpwrfvya
hkdsedwplfvellmegnqkwaknasvllfvisrdhtishegekkpsathsfdagaawfs
lamqahllgyhahgmggifkdrivekldipdgfkveagvaigtltdksilpddlaerevp
skrvpladvafegrftgk

SCOPe Domain Coordinates for d2freb_:

Click to download the PDB-style file with coordinates for d2freb_.
(The format of our PDB-style files is described here.)

Timeline for d2freb_: