Lineage for d2frea1 (2fre A:1-200)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728985Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 728986Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families) (S)
  5. 728987Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins)
  6. 729021Protein NAD(P)H-flavin oxidoreductase Atu0013 [143616] (1 species)
  7. 729022Species Agrobacterium tumefaciens [TaxId:358] [143617] (1 PDB entry)
  8. 729023Domain d2frea1: 2fre A:1-200 [133985]
    complexed with fmn

Details for d2frea1

PDB Entry: 2fre (more details), 1.9 Å

PDB Description: The crystal structure of the oxidoreductase containing FMN
PDB Compounds: (A:) NAD(P)H-flavin oxidoreductase

SCOP Domain Sequences for d2frea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frea1 d.90.1.1 (A:1-200) NAD(P)H-flavin oxidoreductase Atu0013 {Agrobacterium tumefaciens [TaxId: 358]}
mtnsnnrqseypvdplfldrwsprafdgspmpkehlltildaahwapsasnhqpwrfvya
hkdsedwplfvellmegnqkwaknasvllfvisrdhtishegekkpsathsfdagaawfs
lamqahllgyhahgmggifkdrivekldipdgfkveagvaigtltdksilpddlaerevp
skrvpladvafegrftgkad

SCOP Domain Coordinates for d2frea1:

Click to download the PDB-style file with coordinates for d2frea1.
(The format of our PDB-style files is described here.)

Timeline for d2frea1: