SCOPe 2.07: Domain d2frdc1: 2frd C:33-203

Lineage for d2frdc1 (2frd C:33-203)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
   automatically mapped to Pfam PF02233

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)

8. Domain d2frdc1: 2frd C:33-203 [133984]
   Other proteins in same PDB: d2frda1, d2frda2, d2frdb1, d2frdb2
   automatically matched to d1pnoa_
   complexed with nai, ndp

Details for d2frdc1

PDB Entry: 2frd, 3.2 Å

PDB Description: structure of transhydrogenase (di.s138a.nadh)2(diii.nadph)1 asymmetric complex

PDB Compounds: (C:) NAD(P) transhydrogenase subunit beta

SCOPe Domain Sequences for d2frdc1:

Sequence; same for both SEQRES and ATOM records:

>d2frdc1 c.31.1.4 (C:33-203) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
agsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvagrmp
ghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygmpil
dvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

Timeline for d2frdc1:

• d2frdc1 first appeared in SCOP 1.73
  
• d2frdc1 appears in SCOPe 2.06
  
• d2frdc1 appears in the current release, SCOPe 2.08