Lineage for d2frdb2 (2frd B:1-143,B:327-370)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465923Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2465987Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 2465993Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. 2465994Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)
  8. 2466034Domain d2frdb2: 2frd B:1-143,B:327-370 [133983]
    Other proteins in same PDB: d2frda1, d2frdb1, d2frdc1
    automatically matched to d1f8ga2
    complexed with nai, ndp

Details for d2frdb2

PDB Entry: 2frd (more details), 3.2 Å

PDB Description: structure of transhydrogenase (di.s138a.nadh)2(diii.nadph)1 asymmetric complex
PDB Compounds: (B:) NAD(P) transhydrogenase subunit alpha part 1

SCOPe Domain Sequences for d2frdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frdb2 c.23.12.2 (B:1-143,B:327-370) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilasqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtr

SCOPe Domain Coordinates for d2frdb2:

Click to download the PDB-style file with coordinates for d2frdb2.
(The format of our PDB-style files is described here.)

Timeline for d2frdb2: