Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) |
Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins) |
Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species) L-alanine dehydrogenase homologue |
Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries) |
Domain d2frda2: 2frd A:1-143,A:327-370 [133981] Other proteins in same PDB: d2frda1, d2frdb1, d2frdc1 automatically matched to d1f8ga2 complexed with nai, ndp |
PDB Entry: 2frd (more details), 3.2 Å
SCOPe Domain Sequences for d2frda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2frda2 c.23.12.2 (A:1-143,A:327-370) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay amelmprisraqsmdilasqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet vsgtcvtr
Timeline for d2frda2: