SCOP 1.73: Domain d2frab1: 2fra B:1-218

Lineage for d2frab1 (2fra B:1-218)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (17 PDB entries)

8. Domain d2frab1: 2fra B:1-218 [133979]
   automatically matched to d1ms6a_
   complexed with crv

Details for d2frab1

PDB Entry: 2fra, 1.9 Å

PDB Description: human cathepsin s with cra-27934, a nitrile inhibitor

PDB Compounds: (B:) cathepsin S

SCOP Domain Sequences for d2frab1:

Sequence; same for both SEQRES and ATOM records:

>d2frab1 d.3.1.1 (B:1-218) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2frab1:

• d2frab1 is new in SCOP 1.73
  
• d2frab1 appears in SCOP 1.75
  
• d2frab1 appears in the current release, SCOPe 2.08, called d2frab_