Lineage for d2fr8c1 (2fr8 C:33-203)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828384Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 828385Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 828556Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
  6. 828557Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 828567Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)
  8. 828577Domain d2fr8c1: 2fr8 C:33-203 [133977]
    Other proteins in same PDB: d2fr8a1, d2fr8a2, d2fr8b1, d2fr8b2
    automatically matched to d1pnoa_
    complexed with nad, nap; mutant

Details for d2fr8c1

PDB Entry: 2fr8 (more details), 2.6 Å

PDB Description: structure of transhydrogenase (di.r127a.nad+)2(diii.nadp+)1 asymmetric complex
PDB Compounds: (C:) NAD(P) transhydrogenase subunit beta

SCOP Domain Sequences for d2fr8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fr8c1 c.31.1.4 (C:33-203) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
agsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvagrmp
ghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygmpil
dvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOP Domain Coordinates for d2fr8c1:

Click to download the PDB-style file with coordinates for d2fr8c1.
(The format of our PDB-style files is described here.)

Timeline for d2fr8c1: