![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein) binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode |
![]() | Protein Transhydrogenase domain III (dIII) [52485] (3 species) |
![]() | Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries) |
![]() | Domain d2fr8c1: 2fr8 C:33-203 [133977] Other proteins in same PDB: d2fr8a1, d2fr8a2, d2fr8b1, d2fr8b2 automatically matched to d1pnoa_ complexed with nad, nap; mutant |
PDB Entry: 2fr8 (more details), 2.6 Å
SCOP Domain Sequences for d2fr8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fr8c1 c.31.1.4 (C:33-203) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} agsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvagrmp ghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygmpil dvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
Timeline for d2fr8c1:
![]() Domains from other chains: (mouse over for more information) d2fr8a1, d2fr8a2, d2fr8b1, d2fr8b2 |