SCOP 1.75: Domain d2fr6d1: 2fr6 D:10-146

Lineage for d2fr6d1 (2fr6 D:10-146)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (5 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (3 proteins)
   strand 5 is antiparallel to strand 4

6. Protein mono-domain cytidine deaminase [75327] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142830] (3 PDB entries)
   Uniprot P56389 10-146

8. Domain d2fr6d1: 2fr6 D:10-146 [133972]
   automatically matched to 1ZAB A:10-146
   complexed with ctn, nh3, so4, uri, zn

Details for d2fr6d1

PDB Entry: 2fr6, 2.07 Å

PDB Description: crystal structure of mouse cytidine deaminase complexed with cytidine

PDB Compounds: (D:) Cytidine deaminase

SCOP Domain Sequences for d2fr6d1:

Sequence; same for both SEQRES and ATOM records:

>d2fr6d1 c.97.1.1 (D:10-146) mono-domain cytidine deaminase {Mouse (Mus musculus) [TaxId: 10090]}
vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
qellpasfgpedlqkiq

Timeline for d2fr6d1:

• d2fr6d1 first appeared in SCOP 1.73
  
• d2fr6d1 is called d2fr6d_ in SCOPe 2.01
  
• d2fr6d1 appears in the current release, SCOPe 2.08, called d2fr6d_