Lineage for d2fr6d_ (2fr6 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918483Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2918531Protein automated matches [190174] (2 species)
    not a true protein
  7. 2918554Species Mouse (Mus musculus) [TaxId:10090] [186904] (3 PDB entries)
  8. 2918565Domain d2fr6d_: 2fr6 D: [133972]
    automated match to d1mq0a_
    complexed with ctn, nh3, so4, uri, zn

Details for d2fr6d_

PDB Entry: 2fr6 (more details), 2.07 Å

PDB Description: crystal structure of mouse cytidine deaminase complexed with cytidine
PDB Compounds: (D:) Cytidine deaminase

SCOPe Domain Sequences for d2fr6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fr6d_ c.97.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
qellpasfgpedlqkiq

SCOPe Domain Coordinates for d2fr6d_:

Click to download the PDB-style file with coordinates for d2fr6d_.
(The format of our PDB-style files is described here.)

Timeline for d2fr6d_: