![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.1: Cytidine deaminase [53928] (4 proteins) strand 5 is antiparallel to strand 4 |
![]() | Protein automated matches [190174] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186904] (3 PDB entries) |
![]() | Domain d2fr6b_: 2fr6 B: [133970] automated match to d1mq0a_ complexed with ctn, nh3, so4, uri, zn |
PDB Entry: 2fr6 (more details), 2.07 Å
SCOPe Domain Sequences for d2fr6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fr6b_ c.97.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv qellpasfgpedlqk
Timeline for d2fr6b_: