![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.1: Cytidine deaminase [53928] (4 proteins) strand 5 is antiparallel to strand 4 |
![]() | Protein automated matches [190174] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186904] (3 PDB entries) |
![]() | Domain d2fr5c_: 2fr5 C: [133967] automated match to d1mq0a_ protein/RNA complex; complexed with so4, tyu, zn |
PDB Entry: 2fr5 (more details), 1.48 Å
SCOPe Domain Sequences for d2fr5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fr5c_ c.97.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv qellpasfgpedlq
Timeline for d2fr5c_: