SCOP 1.73: Domain d2fr5c1: 2fr5 C:10-143

Lineage for d2fr5c1 (2fr5 C:10-143)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (3 proteins)
   strand 5 is antiparallel to strand 4

6. Protein mono-domain cytidine deaminase [75327] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142830] (3 PDB entries)

8. Domain d2fr5c1: 2fr5 C:10-143 [133967]
   automatically matched to 1ZAB A:10-146
   complexed with so4, tyu, zn

Details for d2fr5c1

PDB Entry: 2fr5, 1.48 Å

PDB Description: Crystal Structure of Mouse Cytidine Deaminase Complexed with Tetrahydrouridine

PDB Compounds: (C:) Cytidine deaminase

SCOP Domain Sequences for d2fr5c1:

Sequence; same for both SEQRES and ATOM records:

>d2fr5c1 c.97.1.1 (C:10-143) mono-domain cytidine deaminase {Mouse (Mus musculus) [TaxId: 10090]}
vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
qellpasfgpedlq

Timeline for d2fr5c1:

• d2fr5c1 is new in SCOP 1.73
  
• d2fr5c1 appears in SCOP 1.75
  
• d2fr5c1 appears in the current release, SCOPe 2.08, called d2fr5c_