Lineage for d2fr5b1 (2fr5 B:11-144)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847589Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 847590Superfamily c.97.1: Cytidine deaminase-like [53927] (5 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 847591Family c.97.1.1: Cytidine deaminase [53928] (3 proteins)
    strand 5 is antiparallel to strand 4
  6. 847608Protein mono-domain cytidine deaminase [75327] (5 species)
  7. 847631Species Mouse (Mus musculus) [TaxId:10090] [142830] (3 PDB entries)
    Uniprot P56389 10-146
  8. 847633Domain d2fr5b1: 2fr5 B:11-144 [133966]
    automatically matched to 1ZAB A:10-146
    complexed with so4, tyu, zn

Details for d2fr5b1

PDB Entry: 2fr5 (more details), 1.48 Å

PDB Description: Crystal Structure of Mouse Cytidine Deaminase Complexed with Tetrahydrouridine
PDB Compounds: (B:) Cytidine deaminase

SCOP Domain Sequences for d2fr5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fr5b1 c.97.1.1 (B:11-144) mono-domain cytidine deaminase {Mouse (Mus musculus) [TaxId: 10090]}
epehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaerta
iqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtvq
ellpasfgpedlqk

SCOP Domain Coordinates for d2fr5b1:

Click to download the PDB-style file with coordinates for d2fr5b1.
(The format of our PDB-style files is described here.)

Timeline for d2fr5b1: