Lineage for d2fr5b_ (2fr5 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918483Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2918531Protein automated matches [190174] (2 species)
    not a true protein
  7. 2918554Species Mouse (Mus musculus) [TaxId:10090] [186904] (3 PDB entries)
  8. 2918556Domain d2fr5b_: 2fr5 B: [133966]
    automated match to d1mq0a_
    protein/RNA complex; complexed with so4, tyu, zn

Details for d2fr5b_

PDB Entry: 2fr5 (more details), 1.48 Å

PDB Description: Crystal Structure of Mouse Cytidine Deaminase Complexed with Tetrahydrouridine
PDB Compounds: (B:) Cytidine deaminase

SCOPe Domain Sequences for d2fr5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fr5b_ c.97.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
epehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaerta
iqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtvq
ellpasfgpedlqk

SCOPe Domain Coordinates for d2fr5b_:

Click to download the PDB-style file with coordinates for d2fr5b_.
(The format of our PDB-style files is described here.)

Timeline for d2fr5b_: