SCOP 1.75: Domain d2fr5a1: 2fr5 A:11-146

Lineage for d2fr5a1 (2fr5 A:11-146)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (5 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (3 proteins)
   strand 5 is antiparallel to strand 4

6. Protein mono-domain cytidine deaminase [75327] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142830] (3 PDB entries)
   Uniprot P56389 10-146

8. Domain d2fr5a1: 2fr5 A:11-146 [133965]
   automatically matched to 1ZAB A:10-146
   complexed with so4, tyu, zn

Details for d2fr5a1

PDB Entry: 2fr5, 1.48 Å

PDB Description: Crystal Structure of Mouse Cytidine Deaminase Complexed with Tetrahydrouridine

PDB Compounds: (A:) Cytidine deaminase

SCOP Domain Sequences for d2fr5a1:

Sequence; same for both SEQRES and ATOM records:

>d2fr5a1 c.97.1.1 (A:11-146) mono-domain cytidine deaminase {Mouse (Mus musculus) [TaxId: 10090]}
epehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaerta
iqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtvq
ellpasfgpedlqkiq

Timeline for d2fr5a1:

• d2fr5a1 first appeared in SCOP 1.73
  
• d2fr5a1 is called d2fr5a_ in SCOPe 2.01
  
• d2fr5a1 appears in the current release, SCOPe 2.08, called d2fr5a_