![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species) |
![]() | Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (74 PDB entries) |
![]() | Domain d2fr3a_: 2fr3 A: [133964] automated match to d1blr__ complexed with act, rea |
PDB Entry: 2fr3 (more details), 1.48 Å
SCOPe Domain Sequences for d2fr3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fr3a_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]} pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli ltmtaddvvctrvyvre
Timeline for d2fr3a_: