SCOPe 2.06: Domain d2fr2a1: 2fr2 A:4-164

Lineage for d2fr2a1 (2fr2 A:4-164)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.8: Rv2717c-like [141475] (3 proteins)
   bacterial and plant proteins with a fatty acid binding protein-like fold
   automatically mapped to Pfam PF08768

6. Protein Hypothetical protein Rv2717c [141476] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [141477] (1 PDB entry)
   Uniprot O07216 4-164

8. Domain d2fr2a1: 2fr2 A:4-164 [133963]

Details for d2fr2a1

PDB Entry: 2fr2, 1.5 Å

PDB Description: Crystal Structure of Rv2717c from M. tuberculosis

PDB Compounds: (A:) hypothetical protein Rv2717c

SCOPe Domain Sequences for d2fr2a1:

Sequence; same for both SEQRES and ATOM records:

>d2fr2a1 b.60.1.8 (A:4-164) Hypothetical protein Rv2717c {Mycobacterium tuberculosis [TaxId: 1773]}
dlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravadgkp
lhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglaptak
evtaldrsyridgdelsyslqmravgqplqdhlaavlhrqr

Timeline for d2fr2a1:

• d2fr2a1 first appeared in SCOP 1.73
  
• d2fr2a1 appears in SCOPe 2.05
  
• d2fr2a1 appears in SCOPe 2.07
  
• d2fr2a1 appears in the current release, SCOPe 2.08